Lineage for d1rsvb_ (1rsv B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354154Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 354256Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 354278Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)
  8. 354312Domain d1rsvb_: 1rsv B: [97818]
    complexed with azi, fe, hg; mutant

Details for d1rsvb_

PDB Entry: 1rsv (more details), 2.2 Å

PDB Description: azide complex of the diferrous e238a mutant r2 subunit of ribonucleotide reductase

SCOP Domain Sequences for d1rsvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsvb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardaal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

SCOP Domain Coordinates for d1rsvb_:

Click to download the PDB-style file with coordinates for d1rsvb_.
(The format of our PDB-style files is described here.)

Timeline for d1rsvb_: