SCOP 1.75: Domain d1rsrb_: 1rsr B:

Lineage for d1rsrb_ (1rsr B:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (9 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (9 species)

7. Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)

8. Domain d1rsrb_: 1rsr B: [97816]
   complexed with azi, fe2, hg; mutant

Details for d1rsrb_

PDB Entry: 1rsr, 2 Å

PDB Description: azide complex of the diferrous f208a mutant r2 subunit of ribonucleotide reductase

PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOP Domain Sequences for d1rsrb_:

Sequence; same for both SEQRES and ATOM records:

>d1rsrb_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairayvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlvs

Timeline for d1rsrb_:

• d1rsrb_ first appeared in SCOP 1.67
  
• d1rsrb_ appears in SCOP 1.73
  
• d1rsrb_ appears in SCOPe 2.01
  
• d1rsrb_ appears in the current release, SCOPe 2.08