Lineage for d1rsra_ (1rsr A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354154Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 354256Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 354278Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)
  8. 354299Domain d1rsra_: 1rsr A: [97815]

Details for d1rsra_

PDB Entry: 1rsr (more details), 2 Å

PDB Description: azide complex of the diferrous F208A mutant R2 subunit of ribonucleotide reductase

SCOP Domain Sequences for d1rsra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rsra_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
sfthiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairayvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfqtrsnpipwintwlv

SCOP Domain Coordinates for d1rsra_:

Click to download the PDB-style file with coordinates for d1rsra_.
(The format of our PDB-style files is described here.)

Timeline for d1rsra_: