SCOP 1.71: Domain d1rqub1: 1rqu B:1-51

Lineage for d1rqub1 (1rqu B:1-51)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
   multihelical; intertwined tetramer

4. Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family)

5. Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)

6. Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)

7. Species Escherichia coli [TaxId:562] [101379] (3 PDB entries)

8. Domain d1rqub1: 1rqu B:1-51 [97775]
   Other proteins in same PDB: d1rqua2, d1rqub2
   includes hinge region 33-51 that is flexible in both chains

Details for d1rqub1

PDB Entry: 1rqu

PDB Description: nmr structure of l7 dimer from e.coli

SCOP Domain Sequences for d1rqub1:

Sequence; same for both SEQRES and ATOM records:

>d1rqub1 a.108.1.1 (B:1-51) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli}
sitkdqiieavaamsvmdvvelisameekfgvsaaaavavaagpveaaeek

Timeline for d1rqub1:

• d1rqub1 first appeared in SCOP 1.67
  
• d1rqub1 appears in SCOP 1.69
  
• d1rqub1 appears in SCOP 1.73
  
• d1rqub1 appears in the current release, SCOPe 2.08