Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Insulin receptor [56162] (1 species) PTK group; InsR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [56163] (15 PDB entries) |
Domain d1rqqb_: 1rqq B: [97761] Other proteins in same PDB: d1rqqc_, d1rqqd_ complexed with adaptor protein Aps complexed with 112, mn |
PDB Entry: 1rqq (more details), 2.6 Å
SCOPe Domain Sequences for d1rqqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqqb_ d.144.1.7 (B:) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} dewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslreriefln easvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpgrppptl qemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyetdyyrkg gkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlkfvmdgg yldqpdncpervtdlmrmcwqfnpnmrptfleivnllkddlhpsfpevsffhseenk
Timeline for d1rqqb_: