Lineage for d1rqkm_ (1rqk M:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1698958Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 1698959Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 1698960Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 1699045Protein M (medium) subunit [81481] (3 species)
  7. 1699046Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 1699060Domain d1rqkm_: 1rqk M: [97749]
    Other proteins in same PDB: d1rqkh1, d1rqkh2, d1rqkl_
    complexed with bcl, bph, cdl, fe, lda, sp2, u10

Details for d1rqkm_

PDB Entry: 1rqk (more details), 2.7 Å

PDB Description: structure of the reaction centre from rhodobacter sphaeroides carotenoidless strain r-26.1 reconstituted with 3,4- dihydrospheroidene
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1rqkm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqkm_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d1rqkm_:

Click to download the PDB-style file with coordinates for d1rqkm_.
(The format of our PDB-style files is described here.)

Timeline for d1rqkm_: