Lineage for d1rqcf_ (1rqc F:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514178Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 514179Superfamily d.167.1: Peptide deformylase [56420] (1 family) (S)
    nickel-dependent enzyme
  5. 514180Family d.167.1.1: Peptide deformylase [56421] (1 protein)
  6. 514181Protein Peptide deformylase [56422] (8 species)
  7. 514223Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)
  8. 514231Domain d1rqcf_: 1rqc F: [97737]

Details for d1rqcf_

PDB Entry: 1rqc (more details), 2.8 Å

PDB Description: Crystals of peptide deformylase from Plasmodium falciparum with ten subunits per asymmetric unit reveal critical characteristics of the active site for drug design

SCOP Domain Sequences for d1rqcf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqcf_ d.167.1.1 (F:) Peptide deformylase {Malaria parasite (Plasmodium falciparum)}
kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathse

SCOP Domain Coordinates for d1rqcf_:

Click to download the PDB-style file with coordinates for d1rqcf_.
(The format of our PDB-style files is described here.)

Timeline for d1rqcf_: