Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (1 family) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (1 protein) |
Protein Peptide deformylase [56422] (8 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries) |
Domain d1rqce_: 1rqc E: [97736] |
PDB Entry: 1rqc (more details), 2.8 Å
SCOP Domain Sequences for d1rqce_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqce_ d.167.1.1 (E:) Peptide deformylase {Malaria parasite (Plasmodium falciparum)} kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseepl
Timeline for d1rqce_: