Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) nickel-dependent enzyme |
Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
Protein Peptide deformylase [56422] (11 species) |
Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries) |
Domain d1rqcc_: 1rqc C: [97734] Other proteins in same PDB: d1rqca2, d1rqcb2, d1rqce2 complexed with co |
PDB Entry: 1rqc (more details), 2.8 Å
SCOPe Domain Sequences for d1rqcc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqcc_ d.167.1.1 (C:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdyka
Timeline for d1rqcc_: