SCOPe 2.07: Domain d1rqca1: 1rqc A:66-239

Lineage for d1rqca1 (1rqc A:66-239)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
   automatically mapped to Pfam PF01327

6. Protein Peptide deformylase [56422] (11 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)

8. Domain d1rqca1: 1rqc A:66-239 [97732]
   Other proteins in same PDB: d1rqca2, d1rqcb2, d1rqce2
   complexed with co

Details for d1rqca1

PDB Entry: 1rqc, 2.8 Å

PDB Description: Crystals of peptide deformylase from Plasmodium falciparum with ten subunits per asymmetric unit reveal critical characteristics of the active site for drug design

PDB Compounds: (A:) formylmethionine deformylase

SCOPe Domain Sequences for d1rqca1:

Sequence; same for both SEQRES and ATOM records:

>d1rqca1 d.167.1.1 (A:66-239) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kivkypdpilrrrseevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwnal
yekrkeenerifinpsiveqslvklkliegclsfpgiegkverpsivsisyydingykhl
kilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykathseep

Timeline for d1rqca1:

• d1rqca1 first appeared in SCOP 1.67, called d1rqca_
  
• d1rqca1 appears in SCOPe 2.06
  
• d1rqca1 appears in the current release, SCOPe 2.08