![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
![]() | Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) ![]() |
![]() | Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
![]() | Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species) E1A and E1B fused together in a single-chain protein |
![]() | Species Escherichia coli [TaxId:562] [75240] (2 PDB entries) |
![]() | Domain d1rp7b3: 1rp7 B:701-886 [97707] Other proteins in same PDB: d1rp7a1, d1rp7a2, d1rp7b1, d1rp7b2 complexed with mg, tzd |
PDB Entry: 1rp7 (more details), 2.09 Å
SCOP Domain Sequences for d1rp7b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rp7b3 c.48.1.1 (B:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli} mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk vnprla
Timeline for d1rp7b3: