Lineage for d1rp7b1 (1rp7 B:471-700)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393127Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 393128Protein Pyruvate dehydrogenase E1 component, Pyr module [88739] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 393129Species Escherichia coli [TaxId:562] [88740] (2 PDB entries)
  8. 393133Domain d1rp7b1: 1rp7 B:471-700 [97705]
    Other proteins in same PDB: d1rp7a2, d1rp7a3, d1rp7b2, d1rp7b3
    complexed with mg, tzd

Details for d1rp7b1

PDB Entry: 1rp7 (more details), 2.09 Å

PDB Description: e. coli pyruvate dehydrogenase inhibitor complex

SCOP Domain Sequences for d1rp7b1:

Sequence, based on SEQRES records: (download)

>d1rp7b1 c.36.1.6 (B:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records): (download)

>d1rp7b1 c.36.1.6 (B:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

SCOP Domain Coordinates for d1rp7b1:

Click to download the PDB-style file with coordinates for d1rp7b1.
(The format of our PDB-style files is described here.)

Timeline for d1rp7b1: