Lineage for d1rp7a3 (1rp7 A:701-886)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 396644Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 396645Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 396646Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 396647Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 396648Species Escherichia coli [TaxId:562] [75240] (2 PDB entries)
  8. 396651Domain d1rp7a3: 1rp7 A:701-886 [97704]
    Other proteins in same PDB: d1rp7a1, d1rp7a2, d1rp7b1, d1rp7b2

Details for d1rp7a3

PDB Entry: 1rp7 (more details), 2.09 Å

PDB Description: e. coli pyruvate dehydrogenase inhibitor complex

SCOP Domain Sequences for d1rp7a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rp7a3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOP Domain Coordinates for d1rp7a3:

Click to download the PDB-style file with coordinates for d1rp7a3.
(The format of our PDB-style files is described here.)

Timeline for d1rp7a3: