SCOPe 2.06: Domain d1rp5b1: 1rp5 B:632-692

Lineage for d1rp5b1 (1rp5 B:632-692)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily)
   alpha1-beta3; 2 layers: alpha/beta; order 132

4. Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family)
   duplication: consists of 2 subdomains of this fold

5. Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein)

6. Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries)

8. Domain d1rp5b1: 1rp5 B:632-692 [97698]
   Other proteins in same PDB: d1rp5a3, d1rp5a4, d1rp5b3, d1rp5b4
   complexed with so4

Details for d1rp5b1

PDB Entry: 1rp5, 3 Å

PDB Description: PBP2x from Streptococcus pneumoniae strain 5259 with reduced susceptibility to beta-lactam antibiotics

PDB Compounds: (B:) penicillin-binding protein 2x

SCOPe Domain Sequences for d1rp5b1:

Sequence; same for both SEQRES and ATOM records:

>d1rp5b1 d.11.1.1 (B:632-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
qqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsd
k

Timeline for d1rp5b1:

• d1rp5b1 first appeared in SCOP 1.67
  
• d1rp5b1 appears in SCOPe 2.05
  
• d1rp5b1 appears in SCOPe 2.07
  
• d1rp5b1 appears in the current release, SCOPe 2.08