Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.11: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54183] (1 superfamily) alpha1-beta3; 2 layers: alpha/beta; order 132 |
Superfamily d.11.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54184] (1 family) duplication: consists of 2 subdomains of this fold |
Family d.11.1.1: Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54185] (1 protein) |
Protein Penicillin-binding protein 2x (pbp-2x), c-terminal domain [54186] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [54187] (10 PDB entries) |
Domain d1rp5b1: 1rp5 B:632-692 [97698] Other proteins in same PDB: d1rp5a3, d1rp5a4, d1rp5b3, d1rp5b4 complexed with so4 |
PDB Entry: 1rp5 (more details), 3 Å
SCOPe Domain Sequences for d1rp5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rp5b1 d.11.1.1 (B:632-692) Penicillin-binding protein 2x (pbp-2x), c-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} qqspypmpsvkdispgdlaeelrrnlvqpivvgtgtkiknssaeegknlapnqqvlilsd k
Timeline for d1rp5b1:
View in 3D Domains from other chains: (mouse over for more information) d1rp5a1, d1rp5a2, d1rp5a3, d1rp5a4 |