SCOP 1.75: Domain d1rleb2: 1rle B:473-593

Lineage for d1rleb2 (1rle B:473-593)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)

8. Domain d1rleb2: 1rle B:473-593 [97643]
   Other proteins in same PDB: d1rlea1, d1rlea4, d1rleb1, d1rleb4

Details for d1rleb2

PDB Entry: 1rle, 2.1 Å

PDB Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium

PDB Compounds: (B:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1rleb2:

Sequence; same for both SEQRES and ATOM records:

>d1rleb2 b.1.5.1 (B:473-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
leteeqepsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhe
vwkdsatmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiild
n

Timeline for d1rleb2:

• d1rleb2 first appeared in SCOP 1.67
  
• d1rleb2 appears in SCOP 1.73
  
• d1rleb2 does not appear in SCOPe 2.01