Lineage for d1rkpa_ (1rkp A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 360609Fold a.125: PDEase [48546] (1 superfamily)
    multihelical; can be divided into three subdomains
  4. 360610Superfamily a.125.1: PDEase [48547] (1 family) (S)
  5. 360611Family a.125.1.1: PDEase [48548] (4 proteins)
    3',5'-cyclic-nucleotide phosphodiesterase, Pfam 00233
  6. 360664Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. 360665Species Human (Homo sapiens) [TaxId:9606] [101440] (3 PDB entries)
  8. 360666Domain d1rkpa_: 1rkp A: [97620]
    complexed with ibm, mg, zn; mutant

Details for d1rkpa_

PDB Entry: 1rkp (more details), 2.05 Å

PDB Description: crystal structure of pde5a1-ibmx

SCOP Domain Sequences for d1rkpa_:

Sequence, based on SEQRES records: (download)

>d1rkpa_ a.125.1.1 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens)}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqrlaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
vsedcfplldgcrknrqkwqalaeqq

Sequence, based on observed residues (ATOM records): (download)

>d1rkpa_ a.125.1.1 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens)}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqrlaelvateffdqgdrekknkipsmqvgfidaiclqlyealthvsedcfplldgcrkn
rqkwqalaeqq

SCOP Domain Coordinates for d1rkpa_:

Click to download the PDB-style file with coordinates for d1rkpa_.
(The format of our PDB-style files is described here.)

Timeline for d1rkpa_: