Lineage for d1rk8c_ (1rk8 C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804793Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1804985Superfamily b.72.3: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain [101931] (1 family) (S)
  5. 1804986Family b.72.3.1: Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain [101932] (1 protein)
  6. 1804987Protein Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain [101933] (1 species)
  7. 1804988Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101934] (1 PDB entry)
  8. 1804989Domain d1rk8c_: 1rk8 C: [97605]
    Other proteins in same PDB: d1rk8a_, d1rk8b_
    protein/RNA complex; complexed with ca

Details for d1rk8c_

PDB Entry: 1rk8 (more details), 1.9 Å

PDB Description: structure of the cytosolic protein pym bound to the mago-y14 core of the exon junction complex
PDB Compounds: (C:) Within the bgcn gene intron protein

SCOPe Domain Sequences for d1rk8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk8c_ b.72.3.1 (C:) Pym (Within the bgcn gene intron protein, WIBG), N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tylqssegkfipatkrpdgtwrkarrvkdgyvp

SCOPe Domain Coordinates for d1rk8c_:

Click to download the PDB-style file with coordinates for d1rk8c_.
(The format of our PDB-style files is described here.)

Timeline for d1rk8c_: