SCOPe 2.04: Domain d1rk4b1: 1rk4 B:92-234

Lineage for d1rk4b1 (1rk4 B:92-234)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)

8. Domain d1rk4b1: 1rk4 B:92-234 [97594]
   Other proteins in same PDB: d1rk4a2, d1rk4b2
   oxidized form; N-domain adopts a different all-alpha dimeric fold

Details for d1rk4b1

PDB Entry: 1rk4, 1.79 Å

PDB Description: Crystal Structure of a Soluble Dimeric Form of Oxidised CLIC1

PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1rk4b1:

Sequence, based on SEQRES records:

>d1rk4b1 a.45.1.1 (B:92-234) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielaye

Sequence, based on observed residues (ATOM records):

>d1rk4b1 a.45.1.1 (B:92-234) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdgvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayaree
fastcpddeeielaye

Timeline for d1rk4b1:

• d1rk4b1 first appeared in SCOP 1.67
  
• d1rk4b1 appears in SCOPe 2.03
  
• d1rk4b1 appears in SCOPe 2.05
  
• d1rk4b1 appears in the current release, SCOPe 2.08