Lineage for d1rjfb1 (1rjf B:4-328)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501678Family c.66.1.37: Leucine carboxy methyltransferase Ppm1 [102569] (1 protein)
  6. 2501679Protein Leucine carboxy methyltransferase Ppm1 [102570] (1 species)
    involved in the regulation of protein phosphatase 2a activity
  7. 2501680Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102571] (6 PDB entries)
  8. 2501694Domain d1rjfb1: 1rjf B:4-328 [97565]
    Other proteins in same PDB: d1rjfa2, d1rjfb2, d1rjfc2
    complexed with bme, gol

Details for d1rjfb1

PDB Entry: 1rjf (more details), 2.25 Å

PDB Description: Structure of PPM1, a leucine carboxy methyltransferase involved in the regulation of protein phosphatase 2A activity
PDB Compounds: (B:) carboxy methyl transferase for protein phosphatase 2A catalytic subunit

SCOPe Domain Sequences for d1rjfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjfb1 c.66.1.37 (B:4-328) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
iiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkv
dkamrssfpvmnygtylrtvgidaaileflvanekvqvvnlgcgsdlrmlpllqmfphla
yvdidynesvelknsilreseilrislglskedtakspflidqgryklaacdlnditett
rlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrf
gaimqsnlkesrnlemptlmtynskekyasrwsaapnvivndmweifnaqipeserkrlr
slqfldeleelkvmqthyilmkaqw

SCOPe Domain Coordinates for d1rjfb1:

Click to download the PDB-style file with coordinates for d1rjfb1.
(The format of our PDB-style files is described here.)

Timeline for d1rjfb1: