Lineage for d1rjba_ (1rjb A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419475Protein Fl cytokine receptor [103298] (1 species)
    PTK group; CSF-1/PDGF receptor subfamily; membrane spanning protein tyrosine kinase
  7. 419476Species Human (Homo sapiens) [TaxId:9606] [103299] (1 PDB entry)
  8. 419477Domain d1rjba_: 1rjb A: [97557]

Details for d1rjba_

PDB Entry: 1rjb (more details), 2.1 Å

PDB Description: Crystal Structure of FLT3
PDB Compounds: (A:)

SCOP Domain Sequences for d1rjba_:

Sequence, based on SEQRES records: (download)

>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens)}
yesqlqmvqvtgssdneyfyvdfreyeydlkwefprenlefgkvlgsgafgkvmnatayg
isktgvsiqvavkmlkekadsserealmselkmmtqlgshenivnllgactlsgpiylif
eyccygdllnylrskrekfsedeieyenqkrleeeedlnvltfedllcfayqvakgmefl
efkscvhrdlaarnvlvthgkvvkicdfglardimsdsnyvvrgnarlpvkwmapeslfe
giytiksdvwsygillweifslgvnpypgipvdanfykliqngfkmdqpfyateeiyiim
qscwafdsrkrpsfpnltsflgcql

Sequence, based on observed residues (ATOM records): (download)

>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens)}
yesqlqmvqvtgssdneyfyvdfreyeydlkwefprenlefgkvlgsgafgkvmnatayg
isktgvsiqvavkmlkerealmselkmmtqlgshenivnllgactlsgpiylifeyccyg
dllnylrskrekfltfedllcfayqvakgmeflefkscvhrdlaarnvlvthgkvvkicd
fglardimsdsnyvvrgnarlpvkwmapeslfegiytiksdvwsygillweifslgvnpy
pgipvdanfykliqngfkmdqpfyateeiyiimqscwafdsrkrpsfpnltsflgcql

SCOP Domain Coordinates for d1rjba_:

Click to download the PDB-style file with coordinates for d1rjba_.
(The format of our PDB-style files is described here.)

Timeline for d1rjba_: