SCOPe 2.01: Domain d1rj6b_: 1rj6 B:

Lineage for d1rj6b_ (1rj6 B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Mouse (Mus musculus), isozyme XIV [TaxId:10090] [101945] (2 PDB entries)

8. Domain d1rj6b_: 1rj6 B: [97534]
   extracellular domain
   complexed with azm, zn

Details for d1rj6b_

PDB Entry: 1rj6, 2.9 Å

PDB Description: crystal structure of the extracellular domain of murine carbonic anhydrase xiv in complex with acetazolamide

PDB Compounds: (B:) Carbonic anhydrase XIV

SCOPe Domain Sequences for d1rj6b_:

Sequence; same for both SEQRES and ATOM records:

>d1rj6b_ b.74.1.1 (B:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]}
wtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldlhn
nghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhyds
qsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvrel
fpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpseplvq
nyrvpqplnqrtifasf

Timeline for d1rj6b_:

• d1rj6b_ first appeared in SCOP 1.67
  
• d1rj6b_ appears in SCOP 1.75
  
• d1rj6b_ appears in SCOPe 2.02
  
• d1rj6b_ appears in the current release, SCOPe 2.08