Lineage for d1rj5a_ (1rj5 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136597Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 1136598Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 1136599Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 1136600Protein Carbonic anhydrase [51071] (10 species)
  7. 1137080Species Mouse (Mus musculus), isozyme XIV [TaxId:10090] [101945] (2 PDB entries)
  8. 1137083Domain d1rj5a_: 1rj5 A: [97531]
    extracellular domain
    complexed with acy, cl, zn

Details for d1rj5a_

PDB Entry: 1rj5 (more details), 2.81 Å

PDB Description: crystal structure of the extracellular domain of murine carbonic anhydrase xiv
PDB Compounds: (A:) Carbonic anhydrase XIV

SCOPe Domain Sequences for d1rj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj5a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]}
hhwtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldl
hnnghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhy
dsqsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvr
elfpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpsepl
vqnyrvpqplnqrtifasf

SCOPe Domain Coordinates for d1rj5a_:

Click to download the PDB-style file with coordinates for d1rj5a_.
(The format of our PDB-style files is described here.)

Timeline for d1rj5a_: