SCOP 1.67: Domain d1rivh2: 1riv H:114-228

Lineage for d1rivh2 (1riv H:114-228)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1rivh2: 1riv H:114-228 [97523]
   Other proteins in same PDB: d1rivh1, d1rivl1, d1rivl2
   part of anti-cocaine Fab M82G2
   complexed with obe

Details for d1rivh2

PDB Entry: 1riv, 2.2 Å

PDB Description: Anti-Cocaine Antibody M82G2 Complexed With meta-Oxybenzoylecgonine

SCOP Domain Sequences for d1rivh2:

Sequence, based on SEQRES records:

>d1rivh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
asttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlq
sdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk

Sequence, based on observed residues (ATOM records):

>d1rivh2 b.1.1.2 (H:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
asttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsdl
ytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk

Timeline for d1rivh2:

• d1rivh2 is new in SCOP 1.67
  
• d1rivh2 appears in SCOP 1.69
  
• d1rivh2 appears in the current release, SCOPe 2.07