Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.2: Phage repressors [47419] (7 proteins) consists of different sequence families of HTH repressors of phage origins |
Protein lambda C1 repressor, DNA-binding domain [47420] (1 species) |
Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries) |
Domain d1rioa1: 1rio A:2-92 [97513] Other proteins in same PDB: d1rioa2, d1riob2, d1rioh_ protein/DNA complex; complexed with ca, mpd |
PDB Entry: 1rio (more details), 2.3 Å
SCOPe Domain Sequences for d1rioa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rioa1 a.35.1.2 (A:2-92) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]} stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay naallakilkvsveefspsiareiyemyeav
Timeline for d1rioa1: