SCOPe 2.08: Domain d1rioa1: 1rio A:2-92

Lineage for d1rioa1 (1rio A:2-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein lambda C1 repressor, DNA-binding domain [47420] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [47421] (5 PDB entries)

8. Domain d1rioa1: 1rio A:2-92 [97513]
   Other proteins in same PDB: d1rioa2, d1riob2, d1rioh_
   protein/DNA complex; complexed with ca, mpd

Details for d1rioa1

PDB Entry: 1rio, 2.3 Å

PDB Description: Structure of bacteriophage lambda cI-NTD in complex with sigma-region4 of Thermus aquaticus bound to DNA

PDB Compounds: (A:) repressor protein ci

SCOPe Domain Sequences for d1rioa1:

Sequence; same for both SEQRES and ATOM records:

>d1rioa1 a.35.1.2 (A:2-92) lambda C1 repressor, DNA-binding domain {Bacteriophage lambda [TaxId: 10710]}
stkkkpltqeqledarrlkaiyekkknelglsqesvadkmgmgqsgvgalfnginalnay
naallakilkvsveefspsiareiyemyeav

Timeline for d1rioa1:

• d1rioa1 first appeared in SCOP 1.67, called d1rioa_
  
• d1rioa1 appears in SCOPe 2.07