Lineage for d1rihl2 (1rih L:108-212)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108335Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1108556Species Mouse (Mus musculus) [TaxId:10090] [88567] (317 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1108732Domain d1rihl2: 1rih L:108-212 [97512]
    Other proteins in same PDB: d1rihh1, d1rihh2, d1rihl1
    part of Fab 14F7

Details for d1rihl2

PDB Entry: 1rih (more details), 2.5 Å

PDB Description: crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
PDB Compounds: (L:) light chain of antibody 14F7

SCOPe Domain Sequences for d1rihl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rihl2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d1rihl2:

Click to download the PDB-style file with coordinates for d1rihl2.
(The format of our PDB-style files is described here.)

Timeline for d1rihl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rihl1