Lineage for d1rihh2 (1rih H:114-215)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107361Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1107666Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1107889Domain d1rihh2: 1rih H:114-215 [97510]
    Other proteins in same PDB: d1rihh1, d1rihl1, d1rihl2
    part of Fab 14F7

Details for d1rihh2

PDB Entry: 1rih (more details), 2.5 Å

PDB Description: crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
PDB Compounds: (H:) heavy chain of antibody 14F7

SCOPe Domain Sequences for d1rihh2:

Sequence, based on SEQRES records: (download)

>d1rihh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records): (download)

>d1rihh2 b.1.1.2 (H:114-215) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
svtvpsstwpsetvtcnvahpasstkvdkkivprdc

SCOPe Domain Coordinates for d1rihh2:

Click to download the PDB-style file with coordinates for d1rihh2.
(The format of our PDB-style files is described here.)

Timeline for d1rihh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rihh1