Lineage for d1rihh1 (1rih H:1-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652563Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 652651Domain d1rihh1: 1rih H:1-113 [97509]
    Other proteins in same PDB: d1rihh2, d1rihl1, d1rihl2
    part of Fab 14F7

Details for d1rihh1

PDB Entry: 1rih (more details), 2.5 Å

PDB Description: crystal structure of fab 14f7, a unique anti-tumor antibody specific for n-glycolyl gm3
PDB Compounds: (H:) heavy chain of antibody 14F7

SCOP Domain Sequences for d1rihh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgnelakpgasmkmscrasgysftsywihwlkqrpdqglewigyidpataytes
nqkfkdkailtadrssntafmylnsltsedsavyycaresprlrrgiyyyamdywgqgtt
vtvss

SCOP Domain Coordinates for d1rihh1:

Click to download the PDB-style file with coordinates for d1rihh1.
(The format of our PDB-style files is described here.)

Timeline for d1rihh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rihh2