Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein) duplication; there are two structural repeats of this fold |
Protein Imidazole glycerol phosphate dehydratase [102767] (3 species) |
Species Fungus (Filobasidiella neoformans) [TaxId:5207] [102768] (1 PDB entry) |
Domain d1rhyb2: 1rhy B:94-188 [97494] complexed with acy, emc, gol, hg, so4 |
PDB Entry: 1rhy (more details), 2.3 Å
SCOPe Domain Sequences for d1rhyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhyb2 d.14.1.9 (B:94-188) Imidazole glycerol phosphate dehydratase {Fungus (Filobasidiella neoformans) [TaxId: 5207]} gikrygyayapldeslsravidissrpyfmchlpftrekvgdlstemvshllqsfafaag vtlhidsirgennhhiaesafkalalairmaisrt
Timeline for d1rhyb2: