SCOPe 2.01: Domain d1rhyb2: 1rhy B:94-188

Lineage for d1rhyb2 (1rhy B:94-188)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
   duplication; there are two structural repeats of this fold

6. Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)

7. Species Fungus (Filobasidiella neoformans) [TaxId:5207] [102768] (1 PDB entry)

8. Domain d1rhyb2: 1rhy B:94-188 [97494]
   complexed with acy, emc, gol, hg, so4

Details for d1rhyb2

PDB Entry: 1rhy, 2.3 Å

PDB Description: crystal structure of imidazole glycerol phosphate dehydratase

PDB Compounds: (B:) Imidazole glycerol phosphate dehydratase

SCOPe Domain Sequences for d1rhyb2:

Sequence; same for both SEQRES and ATOM records:

>d1rhyb2 d.14.1.9 (B:94-188) Imidazole glycerol phosphate dehydratase {Fungus (Filobasidiella neoformans) [TaxId: 5207]}
gikrygyayapldeslsravidissrpyfmchlpftrekvgdlstemvshllqsfafaag
vtlhidsirgennhhiaesafkalalairmaisrt

Timeline for d1rhyb2:

• d1rhyb2 first appeared in SCOP 1.67
  
• d1rhyb2 appears in SCOP 1.75
  
• d1rhyb2 appears in SCOPe 2.02
  
• d1rhyb2 appears in the current release, SCOPe 2.08