SCOPe 2.07: Domain d1rhr.1: 1rhr A:,B:

Lineage for d1rhr.1 (1rhr A:,B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein Apopain (caspase-3, cpp32) [52131] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52132] (28 PDB entries)

8. Domain d1rhr.1: 1rhr A:,B: [97488]
   complexed with cne

Details for d1rhr.1

PDB Entry: 1rhr, 3 Å

PDB Description: crystal structure of the complex of caspase-3 with a cinnamic acid methyl ester inhibitor

PDB Compounds: (A:) Caspase-3, (B:) Caspase-3

SCOPe Domain Sequences for d1rhr.1:

Sequence; same for both SEQRES and ATOM records:

>g1rhr.1 c.17.1.1 (A:,B:) Apopain (caspase-3, cpp32) {Human (Homo sapiens) [TaxId: 9606]}
dnsykmdypemglciiinnknfhkstgmtsrsgtdvdaanlretfrnlkyevrnkndltr
eeivelmrdvskedhskrssfvcvllshgeegiifgtngpvdlkkitnffrgdrcrsltg
kpklfiiqacrgteldcgieXkipveadflyaystapgyyswrnskdgswfiqslcamlk
qyadklefmhiltrvnrkvatefesfsfdatfhakkqipcivsmltkelyfy

Timeline for d1rhr.1:

• d1rhr.1 first appeared in SCOP 1.67
  
• d1rhr.1 appears in SCOPe 2.06
  
• d1rhr.1 appears in the current release, SCOPe 2.08