Lineage for d1rhhb2 (1rhh B:114-216)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365023Species Human (Homo sapiens) [TaxId:9606] [88575] (78 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 365045Domain d1rhhb2: 1rhh B:114-216 [97476]
    Other proteins in same PDB: d1rhha1, d1rhha2, d1rhhb1, d1rhhc1, d1rhhc2, d1rhhd1

Details for d1rhhb2

PDB Entry: 1rhh (more details), 1.9 Å

PDB Description: Crystal Structure of the Broadly HIV-1 Neutralizing Fab X5 at 1.90 Angstrom Resolution

SCOP Domain Sequences for d1rhhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhhb2 b.1.1.2 (B:114-216) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1rhhb2:

Click to download the PDB-style file with coordinates for d1rhhb2.
(The format of our PDB-style files is described here.)

Timeline for d1rhhb2: