SCOPe 2.01: Domain d1rhfb2: 1rhf B:98-182

Lineage for d1rhfb2 (1rhf B:98-182)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Tyrosine-protein kinase receptor tyro3, second domain [101517] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101518] (1 PDB entry)

8. Domain d1rhfb2: 1rhf B:98-182 [97472]
   Other proteins in same PDB: d1rhfa1, d1rhfb1
   complexed with act, epe, zn

Details for d1rhfb2

PDB Entry: 1rhf, 1.96 Å

PDB Description: crystal structure of human tyro3-d1d2

PDB Compounds: (B:) Tyrosine-protein kinase receptor TYRO3

SCOPe Domain Sequences for d1rhfb2:

Sequence; same for both SEQRES and ATOM records:

>d1rhfb2 b.1.1.4 (B:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]}
vpfftvepkdlavppnapfqlsceavgppepvtivwwrgttkiggpapspsvlnvtgvtq
stmfsceahnlkglassrtatvhlq

Timeline for d1rhfb2:

• d1rhfb2 first appeared in SCOP 1.67
  
• d1rhfb2 appears in SCOP 1.75
  
• d1rhfb2 appears in SCOPe 2.02
  
• d1rhfb2 appears in the current release, SCOPe 2.08