Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Tyrosine-protein kinase receptor tyro3, second domain [101517] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101518] (1 PDB entry) |
Domain d1rhfb2: 1rhf B:98-182 [97472] Other proteins in same PDB: d1rhfa1, d1rhfb1 complexed with act, epe, zn |
PDB Entry: 1rhf (more details), 1.96 Å
SCOPe Domain Sequences for d1rhfb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhfb2 b.1.1.4 (B:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} vpfftvepkdlavppnapfqlsceavgppepvtivwwrgttkiggpapspsvlnvtgvtq stmfsceahnlkglassrtatvhlq
Timeline for d1rhfb2: