SCOPe 2.02: Domain d1rhfa1: 1rhf A:7-97

Lineage for d1rhfa1 (1rhf A:7-97)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Tyrosine-protein kinase receptor tyro3, N-terminal domain [101508] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101509] (1 PDB entry)

8. Domain d1rhfa1: 1rhf A:7-97 [97469]
   Other proteins in same PDB: d1rhfa2, d1rhfb2
   complexed with act, epe, zn

Details for d1rhfa1

PDB Entry: 1rhf, 1.96 Å

PDB Description: crystal structure of human tyro3-d1d2

PDB Compounds: (A:) Tyrosine-protein kinase receptor TYRO3

SCOPe Domain Sequences for d1rhfa1:

Sequence; same for both SEQRES and ATOM records:

>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gapvkltvsqgqpvklncsvegmeepdiqwvkdgavvqnldqlyipvseqhwigflslks
versdagrywcqvedggeteisqpvwltveg

Timeline for d1rhfa1:

• d1rhfa1 first appeared in SCOP 1.67
  
• d1rhfa1 appears in SCOPe 2.01
  
• d1rhfa1 appears in SCOPe 2.03
  
• d1rhfa1 appears in the current release, SCOPe 2.08