Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Tyrosine-protein kinase receptor tyro3, N-terminal domain [101508] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101509] (1 PDB entry) |
Domain d1rhfa1: 1rhf A:7-97 [97469] Other proteins in same PDB: d1rhfa2, d1rhfb2 complexed with act, epe, zn |
PDB Entry: 1rhf (more details), 1.96 Å
SCOPe Domain Sequences for d1rhfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} gapvkltvsqgqpvklncsvegmeepdiqwvkdgavvqnldqlyipvseqhwigflslks versdagrywcqvedggeteisqpvwltveg
Timeline for d1rhfa1: