Lineage for d1rg5m_ (1rg5 M:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255327Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 2255328Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 2255329Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 2255419Protein M (medium) subunit [81481] (4 species)
  7. 2255420Species Rhodobacter sphaeroides [TaxId:1063] [81479] (60 PDB entries)
    Uniprot P02953
  8. 2255427Domain d1rg5m_: 1rg5 M: [97426]
    Other proteins in same PDB: d1rg5h1, d1rg5h2, d1rg5l_
    complexed with bcl, bph, cdl, fe, hto, lda, u10

Details for d1rg5m_

PDB Entry: 1rg5 (more details), 2.5 Å

PDB Description: structure of the photosynthetic reaction centre from rhodobacter sphaeroides carotenoidless strain r-26.1
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1rg5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg5m_ f.26.1.1 (M:) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

SCOPe Domain Coordinates for d1rg5m_:

Click to download the PDB-style file with coordinates for d1rg5m_.
(The format of our PDB-style files is described here.)

Timeline for d1rg5m_: