Lineage for d1rfdl2 (1rfd L:108-213)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 365823Domain d1rfdl2: 1rfd L:108-213 [97375]
    Other proteins in same PDB: d1rfdh1, d1rfdh2, d1rfdl1
    part of anti-cocaine Fab M82G2

Details for d1rfdl2

PDB Entry: 1rfd (more details), 2.09 Å

PDB Description: anti-cocaine antibody m82g2
PDB Compounds: (L:)

SCOP Domain Sequences for d1rfdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfdl2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypqditvswkidgaerssgvlnswtdqd
ssdstysmsstltltkdeyerhssytceathktstspitksfnrge

SCOP Domain Coordinates for d1rfdl2:

Click to download the PDB-style file with coordinates for d1rfdl2.
(The format of our PDB-style files is described here.)

Timeline for d1rfdl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rfdl1