SCOP 1.67: Domain d1rfdl1: 1rfd L:1-107

Lineage for d1rfdl1 (1rfd L:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (121 PDB entries)

8. Domain d1rfdl1: 1rfd L:1-107 [97374]
   Other proteins in same PDB: d1rfdh1, d1rfdh2, d1rfdl2
   part of anti-cocaine Fab M82G2

Details for d1rfdl1

PDB Entry: 1rfd, 2.09 Å

PDB Description: anti-cocaine antibody m82g2

SCOP Domain Sequences for d1rfdl1:

Sequence; same for both SEQRES and ATOM records:

>d1rfdl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
divmtqaapsvpvtpgesvsiscrssksllhsngytylhwflqrpgqspqlliyrvsnla
sgvpdrfsgsgsgtaftlrfsrveaedvgvyycmqhleypftfgsgtkleik

Timeline for d1rfdl1:

• d1rfdl1 is new in SCOP 1.67
  
• d1rfdl1 appears in SCOP 1.69
  
• d1rfdl1 appears in the current release, SCOPe 2.08