Lineage for d1rf1e2 (1rf1 E:165-199)

  1. Root: SCOP 1.75
  2. 894739Class h: Coiled coil proteins [57942] (7 folds)
  3. 894740Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 895301Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 895302Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 895367Protein Fibrinogen beta chain [88892] (4 species)
  7. 895376Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries)
    Uniprot P02675
  8. 895382Domain d1rf1e2: 1rf1 E:165-199 [97355]
    Other proteins in same PDB: d1rf1a_, d1rf1b1, d1rf1c1, d1rf1c2, d1rf1d_, d1rf1e1, d1rf1f1, d1rf1f2
    coiled-coil region only
    complexed with ca, fuc, nag; mutant

Details for d1rf1e2

PDB Entry: 1rf1 (more details), 2.53 Å

PDB Description: crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (E:) fibrinogen beta chain

SCOP Domain Sequences for d1rf1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf1e2 h.1.8.1 (E:165-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrvlrsilenlrskiqklesdvsaqmeycrtpctv

SCOP Domain Coordinates for d1rf1e2:

Click to download the PDB-style file with coordinates for d1rf1e2.
(The format of our PDB-style files is described here.)

Timeline for d1rf1e2: