Lineage for d1rf0b1 (1rf0 B:200-459)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2560074Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2560075Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2560076Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 2560077Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 2560084Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
    Uniprot P02675
  8. 2560101Domain d1rf0b1: 1rf0 B:200-459 [97339]
    Other proteins in same PDB: d1rf0a_, d1rf0b2, d1rf0c2, d1rf0d_, d1rf0e2, d1rf0f2
    complexed with ca, nag

Details for d1rf0b1

PDB Entry: 1rf0 (more details), 2.81 Å

PDB Description: Crystal Structure of Fragment D of gammaE132A Fibrinogen
PDB Compounds: (B:) fibrinogen beta chain

SCOPe Domain Sequences for d1rf0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf0b1 d.171.1.1 (B:200-459) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpffp

SCOPe Domain Coordinates for d1rf0b1:

Click to download the PDB-style file with coordinates for d1rf0b1.
(The format of our PDB-style files is described here.)

Timeline for d1rf0b1: