SCOP 1.69: Domain d1rerb1: 1rer B:293-391

Lineage for d1rerb1 (1rer B:293-391)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Fusion glycoprotein E1 [74840] (1 species)

7. Species Semliki forest virus [TaxId:11033] [74841] (2 PDB entries)

8. Domain d1rerb1: 1rer B:293-391 [97329]
   Other proteins in same PDB: d1rera2, d1rerb2, d1rerc2

Details for d1rerb1

PDB Entry: 1rer, 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.

SCOP Domain Sequences for d1rerb1:

Sequence; same for both SEQRES and ATOM records:

>d1rerb1 b.1.18.4 (B:293-391) Fusion glycoprotein E1 {Semliki forest virus}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasceppkdhivpya

Timeline for d1rerb1:

• d1rerb1 first appeared in SCOP 1.67
  
• d1rerb1 appears in SCOP 1.71
  
• d1rerb1 appears in the current release, SCOPe 2.08