SCOP 1.71: Domain d1rera2: 1rer A:1-292

Lineage for d1rera2 (1rer A:1-292)

1. Root: SCOP 1.71

2. Class f: Membrane and cell surface proteins and peptides [56835] (49 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)

6. Protein Fusion glycoprotein E1 [75656] (1 species)

7. Species Semliki forest virus [TaxId:11033] [75657] (2 PDB entries)

8. Domain d1rera2: 1rer A:1-292 [97328]
   Other proteins in same PDB: d1rera1, d1rerb1, d1rerc1

Details for d1rera2

PDB Entry: 1rer, 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.

SCOP Domain Sequences for d1rera2:

Sequence; same for both SEQRES and ATOM records:

>d1rera2 f.10.1.1 (A:1-292) Fusion glycoprotein E1 {Semliki forest virus}
yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftrive

Timeline for d1rera2:

• d1rera2 first appeared in SCOP 1.67
  
• d1rera2 appears in SCOP 1.69
  
• d1rera2 appears in SCOP 1.73
  
• d1rera2 appears in the current release, SCOPe 2.08