Lineage for d1rera1 (1rer A:293-391)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551984Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 552271Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)
  6. 552298Protein Fusion glycoprotein E1 [74840] (1 species)
  7. 552299Species Semliki forest virus [TaxId:11033] [74841] (2 PDB entries)
  8. 552300Domain d1rera1: 1rer A:293-391 [97327]
    Other proteins in same PDB: d1rera2, d1rerb2, d1rerc2

Details for d1rera1

PDB Entry: 1rer (more details), 3.2 Å

PDB Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.

SCOP Domain Sequences for d1rera1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rera1 b.1.18.4 (A:293-391) Fusion glycoprotein E1 {Semliki forest virus}
aptiidltctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkv
tlhfstasaspsfvvslcsaratcsasceppkdhivpya

SCOP Domain Coordinates for d1rera1:

Click to download the PDB-style file with coordinates for d1rera1.
(The format of our PDB-style files is described here.)

Timeline for d1rera1: