Lineage for d1re0b_ (1re0 B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542897Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 542898Family a.118.3.1: Sec7 domain [48426] (5 proteins)
    Pfam 01369
  6. 542899Protein ARF guanine-exchange factor 1 [101413] (1 species)
  7. 542900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101414] (1 PDB entry)
  8. 542901Domain d1re0b_: 1re0 B: [97318]
    Other proteins in same PDB: d1re0a_
    complexed with ARF1
    complexed with afb, cit, gdp, mg

Details for d1re0b_

PDB Entry: 1re0 (more details), 2.4 Å

PDB Description: Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A

SCOP Domain Sequences for d1re0b_:

Sequence, based on SEQRES records: (download)

>d1re0b_ a.118.3.1 (B:) ARF guanine-exchange factor 1 {Baker's yeast (Saccharomyces cerevisiae)}
gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
dqsndkveledkkagkngsesmteddiihvqpdadsvfvlsysiimlntdshnpqvkdhm
tfddysnnlrgcyngkdfprwylhkiytsikvkeivmpeeh

Sequence, based on observed residues (ATOM records): (download)

>d1re0b_ a.118.3.1 (B:) ARF guanine-exchange factor 1 {Baker's yeast (Saccharomyces cerevisiae)}
gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
dqsvqpdadsvfvlsysiimlntdshnpqvkdhmtfddysnnlrgcyngkdfprwylhki
ytsikvkeivmpeeh

SCOP Domain Coordinates for d1re0b_:

Click to download the PDB-style file with coordinates for d1re0b_.
(The format of our PDB-style files is described here.)

Timeline for d1re0b_: