SCOPe 2.06: Domain d1re0a_: 1re0 A:

Lineage for d1re0a_ (1re0 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (16 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (14 PDB entries)
   Uniprot P32889

8. Domain d1re0a_: 1re0 A: [97317]
   Other proteins in same PDB: d1re0b1, d1re0b2
   complexed with a sec7 domain
   complexed with afb, cit, gdp, mg

Details for d1re0a_

PDB Entry: 1re0, 2.4 Å

PDB Description: Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A

PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1re0a_:

Sequence; same for both SEQRES and ATOM records:

>d1re0a_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrn

Timeline for d1re0a_:

• d1re0a_ first appeared in SCOP 1.67
  
• d1re0a_ appears in SCOPe 2.05
  
• d1re0a_ appears in SCOPe 2.07
  
• d1re0a_ appears in the current release, SCOPe 2.08