Lineage for d1rdqe_ (1rdq E:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874422Protein cAMP-dependent PK, catalytic subunit [56116] (4 species)
    AGC group; PKA subfamily; serine/threonine kinase
  7. 874459Species Mouse (Mus musculus) [TaxId:10090] [56119] (17 PDB entries)
  8. 874460Domain d1rdqe_: 1rdq E: [97314]
    complexed with peptide inhibitor, chain B
    complexed with adp, atp, gol, mg, mpd, po4; mutant

Details for d1rdqe_

PDB Entry: 1rdq (more details), 1.26 Å

PDB Description: hydrolysis of atp in the crystal of y204a mutant of camp-dependent protein kinase
PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOP Domain Sequences for d1rdqe_:

Sequence, based on SEQRES records: (download)

>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
qvtdfgfakrvkgrtwtlcgtpealapeiilskgynkavdwwalgvliyemaagyppffa
dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

Sequence, based on observed residues (ATOM records): (download)

>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]}
gnaaasvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnh
yamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggem
fshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfa
krvkgrtwtlcgtpealapeiilskgynkavdwwalgvliyemaagyppffadqpiqiye
kivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqr
kveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef

SCOP Domain Coordinates for d1rdqe_:

Click to download the PDB-style file with coordinates for d1rdqe_.
(The format of our PDB-style files is described here.)

Timeline for d1rdqe_: