Lineage for d1rd4a_ (1rd4 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144675Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 2144749Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 2144750Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 2144782Domain d1rd4a_: 1rd4 A: [97304]
    complexed with l08

Details for d1rd4a_

PDB Entry: 1rd4 (more details), 2.4 Å

PDB Description: an allosteric inhibitor of lfa-1 bound to its i-domain
PDB Compounds: (A:) Integrin alpha-L

SCOPe Domain Sequences for d1rd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rd4a_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vieg

SCOPe Domain Coordinates for d1rd4a_:

Click to download the PDB-style file with coordinates for d1rd4a_.
(The format of our PDB-style files is described here.)

Timeline for d1rd4a_: