SCOPe 2.06: Domain d1rc5d_: 1rc5 D:

Lineage for d1rc5d_ (1rc5 D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (3 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1rc5d_: 1rc5 D: [97286]
   Other proteins in same PDB: d1rc5b2, d1rc5c2
   protein/RNA complex; complexed with mg

Details for d1rc5d_

PDB Entry: 1rc5, 2.3 Å

PDB Description: crystal structure of mg(ii)-complex of rnase iii endonuclease domain from aquifex aeolicus at 2.30 angstrom resolution

PDB Compounds: (D:) Ribonuclease III

SCOPe Domain Sequences for d1rc5d_:

Sequence; same for both SEQRES and ATOM records:

>d1rc5d_ a.149.1.1 (D:) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
gmkmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqys
pnkregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyid
sgrdanftrelfyklfkedilsaikegr

Timeline for d1rc5d_:

• d1rc5d_ first appeared in SCOP 1.67
  
• d1rc5d_ appears in SCOPe 2.05
  
• d1rc5d_ appears in SCOPe 2.07
  
• d1rc5d_ appears in the current release, SCOPe 2.08