Lineage for d1r8se_ (1r8s E:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542897Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 542898Family a.118.3.1: Sec7 domain [48426] (5 proteins)
    Pfam 01369
  6. 542909Protein Exchange factor ARNO [48427] (1 species)
  7. 542910Species Human (Homo sapiens) [TaxId:9606] [48428] (5 PDB entries)
  8. 542911Domain d1r8se_: 1r8s E: [97248]
    Other proteins in same PDB: d1r8sa_
    complexed with bme, fmt, gdp, so3, so4; mutant

Details for d1r8se_

PDB Entry: 1r8s (more details), 1.46 Å

PDB Description: arf1[delta1-17]-gdp in complex with a sec7 domain carrying the mutation of the catalytic glutamate to lysine

SCOP Domain Sequences for d1r8se_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8se_ a.118.3.1 (E:) Exchange factor ARNO {Human (Homo sapiens)}
nrkmamgrkkfnmdpkkgiqflvenellqntpeeiarflykgeglnktaigdylgereel
nlavlhafvdlheftdlnlvqalrqflwsfrlpgkaqkidrmmeafaqryclcnpgvfqs
tdtcyvlsysvimlntdlhnpnvrdkmglerfvamnrgineggdlpeellrnlydsirne
pfkiped

SCOP Domain Coordinates for d1r8se_:

Click to download the PDB-style file with coordinates for d1r8se_.
(The format of our PDB-style files is described here.)

Timeline for d1r8se_: