| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (8 species) |
| Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (8 PDB entries) |
| Domain d1r8qb_: 1r8q B: [97244] Other proteins in same PDB: d1r8qe_, d1r8qf_ complexed with a sec7 domain complexed with afb, g3d, mg, zn; mutant |
PDB Entry: 1r8q (more details), 1.86 Å
SCOP Domain Sequences for d1r8qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r8qb_ c.37.1.8 (B:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq
Timeline for d1r8qb_: