SCOP 1.71: Domain d1r8qa_: 1r8q A:

Lineage for d1r8qa_ (1r8q A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (8 species)

7. Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (8 PDB entries)

8. Domain d1r8qa_: 1r8q A: [97243]
   Other proteins in same PDB: d1r8qe_, d1r8qf_

Details for d1r8qa_

PDB Entry: 1r8q, 1.86 Å

PDB Description: full-length arf1-gdp-mg in complex with brefeldin a and a sec7 domain

SCOP Domain Sequences for d1r8qa_:

Sequence; same for both SEQRES and ATOM records:

>d1r8qa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnq

Timeline for d1r8qa_:

• d1r8qa_ first appeared in SCOP 1.67
  
• d1r8qa_ appears in SCOP 1.69
  
• d1r8qa_ appears in SCOP 1.73
  
• d1r8qa_ appears in the current release, SCOPe 2.08