Lineage for d1r8ca3 (1r8c A:258-437)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1653629Superfamily d.58.16: PAP/Archaeal CCA-adding enzyme, C-terminal domain [55003] (3 families) (S)
  5. 1653645Family d.58.16.2: Archaeal tRNA CCA-adding enzyme [102995] (2 proteins)
    decorated fold with a large insertion
  6. 1653646Protein tRNA nucleotidyltransferase, C-terminal domain [102996] (1 species)
  7. 1653647Species Archaeoglobus fulgidus [TaxId:2234] [102997] (26 PDB entries)
    Uniprot O28126
  8. 1653649Domain d1r8ca3: 1r8c A:258-437 [97232]
    Other proteins in same PDB: d1r8ca1, d1r8ca2
    complexed with mn, na, utp

Details for d1r8ca3

PDB Entry: 1r8c (more details), 1.9 Å

PDB Description: Crystal Structures of an Archaeal Class I CCA-Adding Enzyme and Its Nucleotide
PDB Compounds: (A:) tRNA nucleotidyltransferase

SCOPe Domain Sequences for d1r8ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r8ca3 d.58.16.2 (A:258-437) tRNA nucleotidyltransferase, C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]}
hpleieperlrkiveergtavfavkfrkpdivddnlypqlerasrkifeflerenfmplr
safkaseefcyllfecqikeisrvfrrmgpqfedernvkkflsrnrafrpfiengrwwaf
emrkfttpeegvrsyasthwhtlgknvgesireyfeiisgeklfkepvtaelcemmgvkd

SCOPe Domain Coordinates for d1r8ca3:

Click to download the PDB-style file with coordinates for d1r8ca3.
(The format of our PDB-style files is described here.)

Timeline for d1r8ca3: