Lineage for d1r7xa_ (1r7x A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400342Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 400343Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 400524Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (3 proteins)
  6. 400554Protein Glycosyltransferase B [75278] (1 species)
    involved in blood group antigen biosynthesis
  7. 400555Species Human (Homo sapiens) [TaxId:9606] [75279] (6 PDB entries)
  8. 400561Domain d1r7xa_: 1r7x A: [97213]
    complexed with aig, fuc, hg

Details for d1r7xa_

PDB Entry: 1r7x (more details), 1.97 Å

PDB Description: Glycosyltransferase B in complex with 3-amino-acceptor analog inhibitor
PDB Compounds: (A:)

SCOP Domain Sequences for d1r7xa_:

Sequence, based on SEQRES records: (download)

>d1r7xa_ c.68.1.9 (A:) Glycosyltransferase B {Human (Homo sapiens)}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwq
dvsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssre
aftyerrpqsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhd
eshlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavp

Sequence, based on observed residues (ATOM records): (download)

>d1r7xa_ c.68.1.9 (A:) Glycosyltransferase B {Human (Homo sapiens)}
mvslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfa
ikkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevcerrfls
evdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkdegd
fyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvlspe
ylwdqqllgwpavlrklrftavp

SCOP Domain Coordinates for d1r7xa_:

Click to download the PDB-style file with coordinates for d1r7xa_.
(The format of our PDB-style files is described here.)

Timeline for d1r7xa_: